Overview

  • Product name

  • Description

    Rabbit polyclonal to MTIF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Rat MTIF2 aa 1-201. (N-terminal His and GST Tag; Expressed in E.coli).
    Sequence:

    MNQKLLKLEKLLRFHTICRQLHSLSQRRLLAWWKHGSAPASPVWADWLCA RPWPTDVLTGSALHQHRLLVTKKEKRPPRSQLSPIKTKKEVEVWVGMTVE ELARAMAKDTDCVYEALLNTAIDIDSLEANSHLDEVWIKEVIKKAGMKLK WSKLKLERIRENKDAVRRPGADPALLKPRSPVVTIMGHVDHGKTTLLDKL R


    Database link: Q68FQ5

  • Positive control

    • IHC-P: Rat liver tissue. WB: Rat heart lysate; K562 cell lysate; Recombinant rat MTIF2 protein.
  • General notes

     This product was previously labelled as IF-2(Mt)

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 81 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    One of the essential components for the initiation of protein synthesis. Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex.
  • Tissue specificity

    Expressed in all tissues examined. Highest level in skeletal muscle.
  • Sequence similarities

    Belongs to the IF-2 family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • IF-2(Mt) antibody
    • IF-2Mt antibody
    • IF2(mt) antibody
    • IF2M_HUMAN antibody
    • mitochondrial antibody
    • mitochondrial translational initiation factor 2 antibody
    • Mtif2 antibody
    • Translation initiation factor IF-2 antibody
    • Translation initiation factor IF-2, mitochondrial antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for MTIF2 using ab233180 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-MTIF2 antibody (ab233180) at 2 µg/ml + Recombinant rat MTIF2 protein

    Predicted band size: 81 kDa

  • Anti-MTIF2 antibody (ab233180) at 2 µg/ml + Rat heart tissue lysate

    Predicted band size: 81 kDa

  • Anti-MTIF2 antibody (ab233180) at 2 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Predicted band size: 81 kDa

References

ab233180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up