Overview

  • Product name

  • Description

    Rabbit polyclonal to MTIF3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human MTIF3 aa 1-278.
    Sequence:

    MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLI HAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNM HRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKAN PKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVD VSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKA YKETQETQERDTLNKDHGNDKESNVLHQ


    Database link: Q9H2K0

  • Positive control

    • WB: Mouse small intestine and liver lysates; Rat heart lysates; HeLa whole cell lysate. IHC-P: Human prostate cancer and lung cancer tissues.
  • General notes

     This product was previously labelled as Mitocondrial Translational Initiation Factor 3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 32 kDa.

Target

  • Function

    IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
  • Sequence similarities

    Belongs to the IF-3 family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • DC38 antibody
    • IF 3 antibody
    • IF 3Mt antibody
    • IF-3(Mt) antibody
    • IF-3Mt antibody
    • IF3 antibody
    • IF3(mt) antibody
    • IF3M_HUMAN antibody
    • IF3mt antibody
    • mitochondrial antibody
    • Mt antibody
    • MTIF3 antibody
    • Translation initiation factor IF 3, mitochondrial precursor antibody
    • Translation initiation factor IF-3 antibody
    see all

Images

  • All lanes : Anti-MTIF3 antibody (ab230321) at 1/1000 dilution

    Lane 1 : Mouse small intestine lysate
    Lane 2 : Rat heart lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 32 kDa

  • Paraffin-embedded human prostate cancer tissue stained for MTIF3 using ab230321 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for MTIF3 using ab230321 at 1/100 dilution in immunohistochemical analysis.

References

ab230321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up