Overview

  • Product name

    Anti-MTMR10 antibody - C-terminal
  • Description

    Rabbit polyclonal to MTMR10 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human MTMR10 aa 603-652 (C terminal). The exact sequence is proprietary.
    Sequence:

    PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT


    Database link: Q9NXD2

  • Positive control

    • ACHN whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa.

Target

  • Relevance

    Probable pseudophosphatase. Contains a Glu residue instead of a conserved Cys residue in the dsPTPase catalytic loop which renders it catalytically inactive as a phosphatase.
  • Database links

  • Alternative names

    • MTMR10 antibody
    • Myotubularin related protein 10 antibody

Images

  • Anti-MTMR10 antibody - C-terminal (ab179756) at 1 µg/ml + ACHN whole cell lysate at 10 µg

    Predicted band size: 88 kDa

References

ab179756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up