For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    mtor-antibody-ab2833.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cell Cycle Inhibitors Other
Share by email

Anti-mTOR antibody (ab2833)

  • Datasheet
  • SDS
Reviews (1)Q&A (5)References (11)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-mTOR antibody (ab2833)

    Key features and details

    • Rabbit polyclonal to mTOR
    • Suitable for: WB
    • Reacts with: Rat
    • Isotype: IgG

    You may also be interested in

    Primary
    Product image
    Anti-mTOR (phospho S2448) antibody [EPR426(2)] (ab109268)
    Primary
    Product image
    Anti-mTOR (phospho S2448) antibody (ab1093)
    Protein
    Product image
    Recombinant Human mTOR protein (ab114179)

    View more associated products

    Overview

    • Product name

      Anti-mTOR antibody
      See all mTOR primary antibodies
    • Description

      Rabbit polyclonal to mTOR
    • Host species

      Rabbit
    • Tested Applications & Species

      Application Species
      WB
      Rat
      See all applications and species data
    • Immunogen

      Synthetic peptide (Human) which represents a portion of human Mammalian Target of Rapamycin encoded in part by exons 5 and 6.

    • Positive control

      • Rat liver lysate

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
    • Storage buffer

      pH: 7
      Preservative: 0.1% Sodium azide
      Constituents: 0.021% PBS, 1.764% Sodium citrate, 1.815% Tris
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cell Biology
      • Cell Cycle
      • Cell Cycle Inhibitors
      • Other
      • Epigenetics and Nuclear Signaling
      • DNA / RNA
      • DNA Damage & Repair
      • DNA Damage Response
      • DNA Damage Recognition
      • Cancer
      • Cell cycle
      • Cell cycle inhibitors
      • Other
      • Cardiovascular
      • Heart
      • Cardiogenesis
      • Transcription factors/regulators
      • Kits/ Lysates/ Other
      • Kits
      • ELISA Kits
      • ELISA Kits
      • Growth factors and hormones ELISA kits
      • Metabolism
      • Types of disease
      • Obesity

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Recombinant Protein

      • Recombinant Human mTOR protein (ab114179)
    • Related Products

      • Anti-mTOR antibody (ab2732)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab2833 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Guaranteed

    Tested applications are guaranteed to work and covered by our Abpromise guarantee.

    Predicted

    Predicted to work for this combination of applications and species but not guaranteed.

    Incompatible

    Does not work for this combination of applications and species.

    Application Species
    WB
    Rat
    All applications
    Sheep
    Rabbit
    Horse
    Guinea pig
    Cow
    Dog
    Pig
    Ferret
    Rhesus monkey
    Chinese hamster
    Elephant
    Application Abreviews Notes
    WB (1)
    1/1000 - 1/10000. Detects a band of approximately 289 kDa (predicted molecular weight: 289 kDa).
    Notes
    WB
    1/1000 - 1/10000. Detects a band of approximately 289 kDa (predicted molecular weight: 289 kDa).

    Target

    • Function

      Kinase subunit of both mTORC1 and mTORC2, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino-acids. Growth factor-stimulated mTORC1 activation involves AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino-acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-421', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Phosphorylates MAF1 leading to attenuation of its RNA polymerase III-repressive function. mTORC2 is also activated by growth. factors, but seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'.
    • Tissue specificity

      Expressed in numerous tissues, with highest levels in testis.
    • Sequence similarities

      Belongs to the PI3/PI4-kinase family.
      Contains 1 FAT domain.
      Contains 1 FATC domain.
      Contains 7 HEAT repeats.
      Contains 1 PI3K/PI4K domain.
    • Post-translational
      modifications

      Autophosphorylated; when part of mTORC1 or mTORC2.
    • Cellular localization

      Endoplasmic reticulum membrane. Golgi apparatus membrane. Mitochondrion outer membrane. Lysosome. Cytoplasm. Nucleus > PML body. Shuttles between cytoplasm and nucleus. Accumulates in the nucleus in response to hypoxia (By similarity). Targeting to lysosomes depends on amino acid availability and RRAGA and RRAGB.
    • Target information above from: UniProt accession P42345 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 56718 Rat
      • SwissProt: P42346 Rat
      • Unigene: 11008 Rat
      • Alternative names

        • dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1) antibody
        • FK506 binding protein 12 rapamycin associated protein 1 antibody
        • FK506 binding protein 12 rapamycin associated protein 2 antibody
        • FK506 binding protein 12 rapamycin complex associated protein 1 antibody
        • FK506-binding protein 12-rapamycin complex-associated protein 1 antibody
        • FKBP rapamycin associated protein antibody
        • FKBP12 rapamycin complex associated protein antibody
        • FKBP12-rapamycin complex-associated protein 1 antibody
        • FKBP12-rapamycin complex-associated protein antibody
        • FLJ44809 antibody
        • FRAP antibody
        • FRAP1 antibody
        • FRAP2 antibody
        • Mammalian target of rapamycin antibody
        • Mechanistic target of rapamycin antibody
        • mTOR antibody
        • MTOR_HUMAN antibody
        • OTTHUMP00000001983 antibody
        • RAFT1 antibody
        • Rapamycin and FKBP12 target 1 antibody
        • Rapamycin associated protein FRAP2 antibody
        • Rapamycin target protein 1 antibody
        • Rapamycin target protein antibody
        • RAPT1 antibody
        • Serine/threonine-protein kinase mTOR antibody
        see all

      Images

      • Western blot - Anti-mTOR antibody (ab2833)
        Western blot - Anti-mTOR antibody (ab2833)
        ab2833 at a 1:1000 dilution staining 235 kDa mTOR in rat liver lysate (50 µg) by Western blot (ECL). See "Application notes" field for special conditions. ab2833 at a 1:1000 dilution staining 235 kDa mTOR in rat liver lysate (50 µg) by Western blot (ECL). See "Application notes" field for special conditions.

      Protocols

      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
      • SDS
    • References (11)

      Publishing research using ab2833? Please let us know so that we can cite the reference in this datasheet.

      ab2833 has been referenced in 11 publications.

      • Yuan X  et al. NUCKS1 is a novel regulator of milk synthesis in and proliferation of mammary epithelial cells via the mTOR signaling pathway. J Cell Physiol N/A:N/A (2019). PubMed: 30710349
      • Yu Y  et al. U2AF65 enhances milk synthesis and growth of bovine mammary epithelial cells by positively regulating the mTOR-SREBP-1c signalling pathway. Cell Biochem Funct 37:93-101 (2019). PubMed: 30773658
      • Liu Y  et al. GRP78 regulates milk biosynthesis and the proliferation of bovinemammaryepithelial cells through the mTOR signaling pathway. Cell Mol Biol Lett 24:57 (2019). PubMed: 31660059
      • Li B  et al. Septin6 regulates cell growth and casein synthesis in dairy cow mammary epithelial cells via mTORC1 pathway. J Dairy Res 86:181-187 (2019). PubMed: 31122298
      • Li P  et al. FABP5 is a critical regulator of methionine- and estrogen-induced SREBP-1c gene expression in bovine mammary epithelial cells. J Cell Physiol 234:537-549 (2018). PubMed: 30071125
      View all Publications for this product

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      1-6 of 6 Abreviews or Q&A

      Western blot abreview for Anti-mTOR antibody

      Average
      Abreviews
      Abreviews
      abreview image
      Application
      Western blot
      Sample
      Human Cell lysate - whole cell (Keratinocyte)
      Loading amount
      15 µg
      Specification
      Keratinocyte
      Gel Running Conditions
      Reduced Denaturing (10% gel)
      Blocking step
      Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
      Read More

      Prof. Paul Townsend

      Verified customer

      Submitted Jun 26 2008

      Question

      I am looking for an mTOR antibody produced from an immunogen peptide with close homology to the honey bee TOR homolog. For some of your relevant antibodies the exact sequence is not provided. Could you please send me the immunogen peptide sequence for: ab2833: Synthetic peptide (Human) which represents a portion of human Mammalian Target of Rapamycin encoded in part by exons 5 and 6. ab25880: Synthetic 15 amino acid peptide from the amino terminus of human TOR Thanks so much for your help. I hope one of your antibodies will be a good match.

      Read More

      Abcam community

      Verified customer

      Asked on Jan 28 2006

      Answer

      Thank you for your enquiry. Unfortunately the immunogen sequences for both ab2833 and ab25880 are proprietary. I can however tell you that with regards ab25880; based on an alignment with NCBI accession number XP_625130 [**- *:* * ***: ] the honey bee shows a degree of similarity making it possible that this antibody will cross-react with its homolog. The immunogen sequence for ab2833 is disimilar to fruit fly or mosquito and therefore is unlikely to cross react with honey bee. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

      Read More

      Abcam Scientific Support

      Answered on Jan 31 2006

      Question

      Thank you for your email! We loaded 20 µg as instructed by the specification sheet of the lysate but you are right in pointing out that indeed 50 µg was loaded when using the ab 2833 antibody (we are using both ab 2833 and 2732). Although I am uncertain whether we have 50 µg left of the lysate (50µg is half of what was supplied!) we will load the remaining lysate on the next gel; I have serious doubts that it will make difference however since there was no band at the correct mol weight region.... We are working with the placenta and we have obtained single strong, distinct bands at 230-240 kDa in both human and rat placenta. If we were able to verify that this band indeed is mTOR I believe that our gels may be something for your specification sheet in the future. A positive control (liver lysate) would have been a little help however access to the antigenic peptide would be better. Are there antigenic peptides available for ab 2833 and 2732? Our preliminary data on mTOR in the placenta and in various pregnancy complications has made us quite excited and I will order some related products (1093 and 5454) tonight

      Read More

      Abcam community

      Verified customer

      Asked on Apr 01 2004

      Answer

      Thank you for your email. How did the lysate work out for you? I'm glad to hear that you are getting results with your experimental samples but know how important it is to verify what the band is!

      Read More

      Abcam Scientific Support

      Answered on Apr 06 2004

      Question

      Can you tell me if it should recognize the following section of the FRAP protein (The rapamycin binding domain): SRILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMK SGNVKDLLQAWDLYYHVFRRISK

      Read More

      Abcam community

      Verified customer

      Asked on Apr 02 2004

      Answer

      I'm soory but all the information that we have regarding the immunogen is that it is a synthetic peptide (Human) which represents a portion of human Mammalian Target of Rapamycinencoded in part by exons 5 and 6. If you have any more questions please contact us again.

      Read More

      Abcam Scientific Support

      Answered on Apr 02 2004

      Question

      What is the peptide sequence of the antigen used to raise the mTOR antibody : ab2833?

      Read More

      Abcam community

      Verified customer

      Asked on Apr 02 2004

      Answer

      The sequence of the peptide used is proprietary.

      Read More

      Abcam Scientific Support

      Answered on Apr 02 2004

      Question

      One of the antibodies we have recently purchased from you is anti- mTOR ab2833 which, according to the data sheet, has been tested successfully in western blot. We have a long experience using Western; however so far we have not been able to produce a 235 kDa band shown in your data sheet, instead we obtain a prominent band at half that size. We have so far only used denaturating conditions so my question is whether the 235 kDa band in your data sheet was obtained under denaturating or non-denaturating conditions?? Any other ideas to optimize the western with this particular antibody?

      Read More

      Abcam community

      Verified customer

      Asked on Feb 20 2004

      Answer

      Yes, denaturing conditions were used when this antibody was tested in WB. Consider using a lower percentage gel and long transfer times at low voltage to assure transfer of mTor.

      Read More

      Abcam Scientific Support

      Answered on Feb 24 2004

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.