Overview

  • Product name

  • Description

    Rabbit polyclonal to MTR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MTR aa 923-1265.
    Sequence:

    SLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDY IDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLIS QKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKD SASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYS SIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIR PAPGYPSQPDHTEKLTMWRLADIEQSTGIRLTESLAMAPASAVSGLYFSN LKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD


    Database link: Q99707-1

  • Positive control

    • IHC-P: Human adrenal gland and pancreatic tissues. IP: HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab238483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • 5-methyltetrahydrofolate homocysteine methyltransferase antibody
    • 5-methyltetrahydrofolate-homocysteine methyltransferase antibody
    • cblG antibody
    • Methionine synthase antibody
    • methioninesynthase antibody
    • MS antibody
    • MTR antibody
    • MTR1 antibody
    • PRP20 antibody
    • SRM1 antibody
    • Vitamin-B12 dependent methionine synthase antibody
    see all

Images

  • MTR was immunoprecipitated from 500 µg HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate with ab238483 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in HeLa whole cell lysate.

    Lane 2: ab238483 IP in HeLa whole cell lysate.

    Lane 3: HeLa whole cell lysate 10 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

  • Paraffin-embedded human adrenal gland tissue stained for MTR using ab238483 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for MTR using ab238483 at 1/100 dilution in immunohistochemical analysis.

References

ab238483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up