Overview

  • Product name

  • Description

    Rabbit polyclonal to MTRR/MSR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MTRR/ MSR aa 1-725.
    Sequence:

    MGAASVRAGARLVEVALCSFTVTCLEVMRRFLLLYATQQGQAKAIAEEIC EQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFV KEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHF YDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPA SSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIED FESSLTRSVPPLSQASLNIPGLPPEYLQVHLQESLGQEESQVSVTSADPV FQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSE VQSLLQRLQLEDKREHCVLLKIKADTKKKGATLPQHIPAGCSLQFIFTWC LEIRAIPKKAFLRALVDYTSDSAEKRRLQELCSKQGAADYSRFVRDACAC LLDLLLAFPSCQPPLSLLLEHLPKLQPRPYSCASSSLFHPGKLHFVFNIV EFLSTATTEVLRKGVCTGWLALLVASVLQPNIHASHEDSGKALAPKISIS PRTTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGA MWLFFGCRHKDRDYLFRKELRHFLKHGILTHLKVSFSRDAPVGEEEAPAK YVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKEVG VEKLEAMKTLATLKEEKRYLQDIWS


    Database link: Q9UBK8-1

  • Positive control

    • WB: PC-3 and HepG2 whole cell lysate (ab7900). IHC-P: Human pancreas tissue.
  • General notes

    Previously labelled as MTRR. 

Properties

Applications

Our Abpromise guarantee covers the use of ab235354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    MTRR/MSR is involved in the reductive regeneration of cob(I)alamin cofactor required for the maintenance of methionine synthase in a functional state.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • [methionine synthase] cobalamin methyltransferase (cob(II)alamin reducing) antibody
    • 5 methyltetrahydrofolate homocysteine methyltransferase reductase antibody
    • cblE antibody
    • Methionine synthase reductase antibody
    • Methionine synthase reductase, mitochondrial antibody
    • MGC129643 antibody
    • MSR antibody
    • MTRR antibody
    see all

Images

  • All lanes : Anti-MTRR/MSR antibody (ab235354) at 1/500 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human pancreas tissue stained for MTRR/MSR using ab235354 at 1/100 dilution in immunohistochemical analysis.

References

ab235354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up