Overview

  • Product name

    Anti-MTTP/MTP antibody - C-terminal
    See all MTTP/MTP primary antibodies
  • Description

    Rabbit polyclonal to MTTP/MTP - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Human MTTP/MTP aa 663-712 (C terminal). The exact sequence is proprietary.
    Sequence:

    QVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSD


    Database link: P55157

  • Positive control

    • Mouse liver lysate
  • General notes

     This product was previously labelled as MTTP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 99 kDa.

Target

Images

  • Anti-MTTP/MTP antibody - C-terminal (ab186446) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size: 99 kDa

References

This product has been referenced in:

  • Sheldon RD  et al. Chronic NOS inhibition accelerates NAFLD progression in an obese rat model. Am J Physiol Gastrointest Liver Physiol 308:G540-9 (2015). Read more (PubMed: 25573175) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up