Overview

  • Product name

  • Description

    Rabbit polyclonal to MTX1/MTX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human MTX1/MTX aa 175-387. Expressed in E.coli.
    Sequence:

    VLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKIITHLR KEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRK WYAEAMPFPLNFFLPGRMQRQYMERLQLLTGEHRPEDEEELEKELYREAR ECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLR GLHNLCAYCTHIL


    Database link: Q13505

  • Positive control

    • WB: Recombinant human MTX1/MTX protein; Jurkat and MCF7 cell lysates; Rat cerebrum lysate. IHC-P: Human stomach and kidney tissue.
  • General notes

     This product was previously labelled as MTX1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 51 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-MTX1/MTX antibody (ab233205) at 2 µg/ml + Recombinant human MTX1/MTX protein

    Predicted band size: 51 kDa

  • Anti-MTX1/MTX antibody (ab233205) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 51 kDa

  • Anti-MTX1/MTX antibody (ab233205) at 2 µg + Rat cerebrum lysate

    Predicted band size: 51 kDa

  • Anti-MTX1/MTX antibody (ab233205) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 51 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for MTX1/MTX using ab233205 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for MTX1/MTX using ab233205 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233205.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up