Overview

  • Product name

  • Description

    Rabbit polyclonal to MTX1/MTX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human MTX1/MTX aa 217-466.
    Sequence:

    HKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTK NYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLTGEHRPEDEEELE KELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPS GKLQVHLRGLHNLCAYCTHILSLYFPWDGAEVPPQRQTPAGPETEEEPYR RRNQILSVLAGLAAMVGYALLSGIVSIQRATPARAPGTRTLGMAEEDEEE


    Database link: Q13505-1

  • Positive control

    • WB: Jurkat, A549, HepG2 and MCF7 whole cell lysates.
  • General notes

     This product was previously labelled as MTX1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab234663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 51 kDa.

Target

Images

  • All lanes : Anti-MTX1/MTX antibody (ab234663) at 1/1000 dilution

    Lane 1 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : A549 (Human lung carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 51 kDa

References

ab234663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up