Overview

  • Product name

  • Description

    Rabbit polyclonal to MTX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human MTX2 aa 1-263.
    Sequence:

    MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQM CNLPIKVVCRANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLS DGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYP WPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQ PYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYS NLLAFCRRIEQHYFEDRGKGRLS


    Database link: O75431

  • Positive control

    • IHC-P: Human kidney and heart tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human kidney tissue stained for MTX2 using ab234783 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human heart tissue stained for MTX2 using ab234783 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling MTX2 using ab234783 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up