Overview

  • Product name

    Anti-mu Crystallin antibody
    See all mu Crystallin primary antibodies
  • Description

    Rabbit polyclonal to mu Crystallin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human mu Crystallin aa 152-235.
    Sequence:

    YEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVI ITVTLATEPILFGEWVKPGAHINAVGASRPDWRE


    Database link: Q14894

  • Positive control

    • Human cerebral cortex tissue; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling mu Crystallin with ab220085 at 1/200 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling mu Crystallin with ab220085 at 4 µg/mL (green).

References

ab220085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up