Overview

  • Product name

    Anti-MUC15 antibody
  • Description

    Rabbit polyclonal to MUC15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MUC15 aa 24-173.
    Sequence:

    KENQDINTTQNIAEVFKTMENKPISLESEANLNSDKENITTSNLKASHSP PLNLPNNSHGITDFSSNSSAEHSLGSLKPTSTISTSPPLIHSFVSKVPWN APIADEDLLPISAHPNATPALSSENFTWSLVNDTVKTPDNSSITVSILSS


    Database link: Q8N387

  • Positive control

    • IHC-P: Human epididymis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in the cell adhesion to the extracellular matrix.
  • Tissue specificity

    Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, bone marrow, lymph node and lung.
  • Post-translational
    modifications

    Highly glycosylated (N- and O-linked carbohydrates).
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Component II antibody
    • Glycoprotein 4 antibody
    • Glycoprotein C antibody
    • MUC 15 antibody
    • MUC-15 antibody
    • Muc15 antibody
    • MUC15_HUMAN antibody
    • Mucin 15 antibody
    • Mucin 15 cell surface associated antibody
    • Mucin-15 antibody
    • PAS3 antibody
    • PASIII antibody
    see all

Images

  • Paraffin embedded human epididymis tissue stained for MUC15 with ab224468 (1/200 dilution) in immunohistochemical analysis.

References

ab224468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up