Overview

  • Product name

  • Description

    Rabbit polyclonal to MUC16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human MUC16 aa 13977-14117. (Expressed in E.coli).
    Sequence:

    RVIALRSVKNGAETRVDLLCTYLQPLSGPGLPIKQVFHELSQQTHGITRL GPYSLDKDSLYLNGYNEPGPDEPPTTPKPATTFLPPLSEATTAMGYHLKT LTLNFTISNLQYSPDMGKGSATFNSTEGVLQHLLRPLFQKS


    Database link: Q8WXI7

  • Positive control

    • WB: Human liver tissue lysate; Recombinant human MUC16 protein. IHC-P: Human liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
  • Tissue specificity

    Expressed in corneal and conjunctival epithelia (at protein level). Overexpressed in ovarian carcinomas and ovarian low malignant potential (LMP) tumors as compared to the expression in normal ovarian tissue and ovarian adenomas.
  • Sequence similarities

    Contains 2 ANK repeats.
    Contains 56 SEA domains.
  • Domain

    Composed of three domains, a Ser-, Thr-rich N-terminal domain, a repeated domain containing more than 60 partially conserved tandem repeats of 156 amino acids each (AAs 12061-21862) and a C-terminal transmembrane contain domain with a short cytoplasmic tail.
  • Post-translational
    modifications

    Heavily O-glycosylated; expresses both type 1 and type 2 core glycans.
    Heavily N-glycosylated; expresses primarily high mannose and complex bisecting type N-linked glycans.
    May be phosphorylated. Phosphorylation of the intracellular C-terminal domain may induce proteolytic cleavage and the liberation of the extracellular domain into the extracellular space.
    May contain numerous disulfide bridges. Association of several molecules of the secreted form may occur through interchain disulfide bridges providing an extraordinarily large gel-like matrix in the extracellular space or in the lumen of secretory ducts.
  • Cellular localization

    Cell membrane. Secreted > extracellular space. May be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus which induces the proteolytic cleavage and liberation of the extracellular domain.
  • Information by UniProt
  • Alternative names

    • CA 125 antibody
    • CA-125 antibody
    • CA125 antibody
    • CA125 ovarian cancer antigen antibody
    • Cancer antigen 125 antibody
    • FLJ14303 antibody
    • MUC 16 antibody
    • MUC-16 antibody
    • MUC16 antibody
    • MUC16_HUMAN antibody
    • Mucin 16 antibody
    • Mucin 16 cell surface associated antibody
    • Mucin-16 antibody
    • Mucin16 antibody
    • Ovarian cancer related tumor marker CA125 antibody
    • Ovarian cancer-related tumor marker CA125 antibody
    • Ovarian carcinoma antigen CA125 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for MUC16 using ab232757 at 20 µg/ml in immunohistochemical analyis. DAB staining.

  • Anti-MUC16 antibody (ab232757) at 3 µg/ml + Recombinant human MUC16 protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-MUC16 antibody (ab232757) at 3 µg/ml + Human liver lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

References

ab232757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up