Overview

  • Product name

  • Description

    Rabbit polyclonal to MUC20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment corresponding to Rat MUC20 aa 113-347. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    TTPAKDSVAFSISHIKLTTCITEIETTITISGTPDASRSPAEAMTALSAS EMLTLPPSTEAKPVVPKTTSSSGILSTATTLALATTLEGTLPASGITESE IAVAQTPTSSGTSATGGTQVTVRRNPLEDTSALSSETQSHTEVFGTITVP TVAGSTVGEATSLVSSTALDSSLSAVVTTKGSASSETLTTDNTTNSSFLT GSRPPSLIYSTTASTSERTNVTLTKTTASPKTPMN


    Database link: B2RZ35

  • Positive control

    • IHC-P: Rat liver, testis and kidney tissues. WB: Rat serum; Rat liver and kidney lysates; Recombinant rat MUC20 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231659 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Function

    May regulate MET signaling cascade. Seems to decrease hepatocyte growth factor (HGF)-induced transient MAPK activation. Blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway. Inhibits HGF-induced proliferation of MMP1 and MMP9 expression.
  • Tissue specificity

    Highly expressed in kidney, moderately in placenta, lung, prostate, liver, and digestive system. In the kidney, localized in the proximal tubules but not in the glomerulus or distal tubules. Detected in most of the male urogenital tract epithelia, with the exception of epididymis.
  • Cellular localization

    Secreted. Apical cell membrane. Basolateral cell membrane. Cell projection > microvillus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MUC 20 antibody
    • MUC-20 antibody
    • Muc20 antibody
    • MUC20_HUMAN antibody
    • Mucin 20 antibody
    • Mucin 20, cell surface associated antibody
    • Mucin-20 antibody
    • Transmembrane mucin MUC20S antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for MUC20 using ab231659 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat testis tissue stained for MUC20 using ab231659 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for MUC20 using ab231659 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-MUC20 antibody (ab231659) at 1 µg/ml + Recombinant rat MUC20 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

  • All lanes : Anti-MUC20 antibody (ab231659) at 1 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat liver lysate
    Lane 3 : Rat kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 43 kDa

References

ab231659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up