Overview

  • Product name

  • Description

    Rabbit polyclonal to Munc18-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human Munc18-2 aa 110-210.
    Sequence:

    CPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCP FRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKL N


    Database link: Q15833

  • Positive control

    • IHC-P: Human gallbladder tissue. ICC/IF: RT4 cells.
  • General notes

     This product was previously labelled as STXBP2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton-X 100.

Target

  • Function

    Involved in intracellular vesicle trafficking and vesicle fusion with membranes. Contributes to the granule exocytosis machinery through interaction with soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) proteins that regulate membrane fusion. Regulates cytotoxic granule exocytosis in natural killer (NK) cells.
  • Tissue specificity

    Placenta, lung, liver, kidney and pancreas, as well as in peripheral blood lymphocytes.
  • Involvement in disease

    Defects in STXBP2 are the cause of hemophagocytic lymphohistiocytosis familial type 5 (FHL5) [MIM:613101]. FHL5 is rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia.
  • Sequence similarities

    Belongs to the STXBP/unc-18/SEC1 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • FHL5 antibody
    • Hunc18b antibody
    • MUNC18 2 antibody
    • pp10122 antibody
    • Protein unc-18 homolog 2 antibody
    • Protein unc-18 homolog B antibody
    • STXB2_HUMAN antibody
    • Stxbp2 antibody
    • syntaxin binding protein 2 antibody
    • Syntaxin-binding protein 2 antibody
    • Unc-18B antibody
    • UNC18 2 antibody
    • Unc18-2 antibody
    • UNC18B antibody
    see all

Images

  • Paraffin-embedded human gallbladder tissue stained for Munc18-2 using ab224376 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for Munc18-2 (green) using ab224376 at 4 µg/ml in ICC/IF.

References

ab224376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up