Overview

  • Product name

  • Description

    Rabbit polyclonal to Munc18c
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Munc18c aa 266-528.
    Sequence:

    NDTYKYKTDGKEKEAILEEEDDLWVRIRHRHIAVVLEEIPKLMKEISSTK KATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNLAEDCMNKFKLNIEKL CKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSI NGTTEENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSA EETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQ KPRANYLEDRKNG


    Database link: O00186

  • Positive control

    • WB: Mouse kidney tissue lysate. IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 68 kDa (predicted molecular weight: 68 kDa).

Target

  • Function

    Together with STX4 and VAMP2, may play a role in insulin-dependent movement of GLUT4 and in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes.
  • Tissue specificity

    Megakaryocytes and platelets.
  • Sequence similarities

    Belongs to the STXBP/unc-18/SEC1 family.
  • Post-translational
    modifications

    Phosphorylated by PKC in platelets in response to thrombin stimulation; phosphorylation inhibits binding to STX4.
  • Cellular localization

    Cytoplasm > cytosol. Cell membrane. In platelets, predominantly cytosolic. Low amounts membrane-associated.
  • Information by UniProt
  • Database links

  • Alternative names

    • Munc18 3 antibody
    • Munc18 c antibody
    • Platelet Sec1 protein antibody
    • Protein unc-18 homolog 3 antibody
    • Protein unc-18 homolog C antibody
    • PSP antibody
    • STXB3_HUMAN antibody
    • STXBP 3 antibody
    • STXBP3 antibody
    • Sxtbp3 antibody
    • syntaxin 4 binding protein antibody
    • Syntaxin binding protein 3 antibody
    • Syntaxin-binding protein 3 antibody
    • Unc 18 3 antibody
    • Unc 18 homolog 3 antibody
    • Unc 18c antibody
    • Unc-18C antibody
    • Unc18-3 antibody
    see all

Images

  • Anti-Munc18c antibody (ab224625) at 1/500 dilution + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 68 kDa
    Observed band size: 68 kDa

  • Paraffin-embedded human adrenal gland tissue stained for Munc18c using ab224625 at 1/100 dilution in immunohistochemical analysis.

References

ab224625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up