Overview

  • Product name

    Anti-Muscarinic Acetylcholine Receptor 1/CHRM1 antibody - Cytoplasmic domain
    See all Muscarinic Acetylcholine Receptor 1/CHRM1 primary antibodies
  • Description

    Rabbit polyclonal to Muscarinic Acetylcholine Receptor 1/CHRM1 - Cytoplasmic domain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Pig, Rhesus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Muscarinic Acetylcholine Receptor 1/CHRM1 aa 210-366.
    Sequence:

    RIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRC CRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDP EAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVK EKKAART


    Database link: P11229

  • Positive control

    • HepG2 cell line extract.
  • General notes

     This product was previously labelled as Muscarinic Acetylcholine Receptor 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab180636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 51 kDa.

Target

  • Relevance

    The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. Muscarinic receptors are so called as they are more sensitive to the effects of the alkaloid muscarine, rather than nicotine.
  • Cellular localization

    Cell Membrane; multi-pass membrane protein
  • Database links

  • Alternative names

    • AChR antibody
    • Cholinergic receptor muscarinic 1 antibody
    • CHRM1 antibody
    • HM1 antibody
    • M1 antibody
    • Muscarinic acetylcholine receptor M1 antibody
    see all

References

This product has been referenced in:

  • Wei W  et al. Muscarinic cholinergic signaling and overactive bladder-like symptoms associated with invasive bladder cancer. Oncol Lett 16:775-784 (2018). Read more (PubMed: 29963145) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up