For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    muscarinic-acetylcholine-receptor-m3chrm3-antibody-ab167566.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels GPCR Muscarinic Receptors
Share by email

Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)
  • Western blot - Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)

Key features and details

  • Mouse polyclonal to Muscarinic Acetylcholine Receptor M3/CHRM3
  • Suitable for: WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody
    See all Muscarinic Acetylcholine Receptor M3/CHRM3 primary antibodies
  • Description

    Mouse polyclonal to Muscarinic Acetylcholine Receptor M3/CHRM3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Chimpanzee, Gorilla
  • Immunogen

    Full length protein corresponding to Human Muscarinic Acetylcholine Receptor M3/CHRM3 aa 1-590.
    Sequence:

    MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFS SPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLK TVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYV ASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLW APAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTIL YWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSA SSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVD LERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKS TATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAF IITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKT FRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL


    Database link: NP_000731.1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa cell lysate; Muscarinic Acetylcholine Receptor M3/CHRM3 transfected 293T cell lysate.
  • General notes

    This product was previously labelled as Muscarinic Acetylcholine Receptor M3.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.40
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • Muscarinic Receptors
    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • Acetylcholine

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HeLa whole cell lysate (ab29545)

Applications

Our Abpromise guarantee covers the use of ab167566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa.

Target

  • Function

    The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM3 sub-subfamily.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Basolateral cell membrane.
  • Target information above from: UniProt accession P20309 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 469725 Chimpanzee
    • Entrez Gene: 281685 Cow
    • Entrez Gene: 101154508 Gorilla
    • Entrez Gene: 1131 Human
    • Entrez Gene: 12671 Mouse
    • Entrez Gene: 100144478 Pig
    • Entrez Gene: 24260 Rat
    • Omim: 118494 Human
    • SwissProt: Q9N2A4 Chimpanzee
    • SwissProt: P41984 Cow
    • SwissProt: Q9N2A3 Gorilla
    • SwissProt: P20309 Human
    • SwissProt: Q9ERZ3 Mouse
    • SwissProt: P11483 Pig
    • SwissProt: P08483 Rat
    • Unigene: 6316 Chimpanzee
    • Unigene: 501 Cow
    • Unigene: 7138 Human
    • Unigene: 342315 Mouse
    • Unigene: 87735 Rat
    see all
  • Alternative names

    • AChR antibody
    • ACM3_HUMAN antibody
    • cholinergic receptor muscarinic 3 antibody
    • CHRM 3 antibody
    • CHRM3 antibody
    • EGBRS antibody
    • HM 3 antibody
    • HM3 antibody
    • m3 muscarinic acetylcholine receptor antibody
    • M3 muscarinic receptor antibody
    • muscarinic 3 antibody
    • Muscarinic acetylcholine receptor M3 antibody
    • muscarinic cholinergic m3 receptor antibody
    • muscarinic m3 receptor antibody
    see all

Images

  • Western blot - Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)
    Western blot - Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)
    Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566) at 1 µg/ml + HeLa cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 66 kDa

  • Western blot - Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)
    Western blot - Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)
    All lanes : Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566) at 1 µg/ml

    Lane 1 : Muscarinic Acetylcholine Receptor M3/CHRM3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 66 kDa

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab167566? Please let us know so that we can cite the reference in this datasheet.

    ab167566 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab167566.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.