Overview

  • Product name
    Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody
    See all Muscarinic Acetylcholine Receptor M3/CHRM3 primary antibodies
  • Description
    Mouse polyclonal to Muscarinic Acetylcholine Receptor M3/CHRM3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Chimpanzee, Gorilla
  • Immunogen

    Full length protein corresponding to Human Muscarinic Acetylcholine Receptor M3/CHRM3 aa 1-590.
    Sequence:

    MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFS SPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLK TVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYV ASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLW APAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTIL YWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSA SSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVD LERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKS TATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAF IITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKT FRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL


    Database link: NP_000731.1

  • Positive control
    • HeLa cell lysate; Muscarinic Acetylcholine Receptor M3/CHRM3 transfected 293T cell lysate.
  • General notes

     This product was previously labelled as Muscarinic Acetylcholine Receptor M3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab167566 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa.

Target

Images

  • Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566) at 1 µg/ml + HeLa cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 66 kDa

  • All lanes : Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566) at 1 µg/ml

    Lane 1 : Muscarinic Acetylcholine Receptor M3/CHRM3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 66 kDa

References

ab167566 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167566.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up