Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566)
Key features and details
- Mouse polyclonal to Muscarinic Acetylcholine Receptor M3/CHRM3
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody
See all Muscarinic Acetylcholine Receptor M3/CHRM3 primary antibodies -
Description
Mouse polyclonal to Muscarinic Acetylcholine Receptor M3/CHRM3 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Pig, Chimpanzee, Gorilla -
Immunogen
Full length protein corresponding to Human Muscarinic Acetylcholine Receptor M3/CHRM3 aa 1-590.
Sequence:MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFS SPDGTTDDPLGGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLK TVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYV ASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLW APAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTIL YWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSA SSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVD LERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKS TATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAF IITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVNPVCYALCNKT FRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
Database link: NP_000731.1 -
Positive control
- HeLa cell lysate; Muscarinic Acetylcholine Receptor M3/CHRM3 transfected 293T cell lysate.
-
General notes
This product was previously labelled as Muscarinic Acetylcholine Receptor M3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.40
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab167566 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa. |
Target
-
Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM3 sub-subfamily. -
Cellular localization
Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Basolateral cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 469725 Chimpanzee
- Entrez Gene: 281685 Cow
- Entrez Gene: 101154508 Gorilla
- Entrez Gene: 1131 Human
- Entrez Gene: 12671 Mouse
- Entrez Gene: 100144478 Pig
- Entrez Gene: 24260 Rat
- Omim: 118494 Human
see all -
Alternative names
- AChR antibody
- ACM3_HUMAN antibody
- cholinergic receptor muscarinic 3 antibody
see all
Images
-
Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566) at 1 µg/ml + HeLa cell lysate at 50 µg
Secondary
Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Predicted band size: 66 kDa -
All lanes : Anti-Muscarinic Acetylcholine Receptor M3/CHRM3 antibody (ab167566) at 1 µg/ml
Lane 1 : Muscarinic Acetylcholine Receptor M3/CHRM3 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Predicted band size: 66 kDa
Datasheets and documents
References (0)
ab167566 has not yet been referenced specifically in any publications.