Overview

  • Product name

    Anti-Muscarinic Acetylcholine Receptor M4/CHRM4 antibody
    See all Muscarinic Acetylcholine Receptor M4/CHRM4 primary antibodies
  • Description

    Rabbit polyclonal to Muscarinic Acetylcholine Receptor M4/CHRM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Muscarinic Acetylcholine Receptor M4/CHRM4 aa 1-31 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MANFTPVNGSSGNQSVRLVTSSSHNRYETVE


    Database link: P08173

  • Positive control

    • Rat brain and human lung carcinoma issues.
  • General notes

     This product was previously labelled as Muscarinic Acetylcholine Receptor M4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab214458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 dilution if using a fluorescent secondary antibody.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Muscarinic Acetylcholine Receptor M4/CHRM4 with ab214458 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling Muscarinic Acetylcholine Receptor M4/CHRM4 with ab214458 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Muscarinic Acetylcholine Receptor M4/CHRM4 with ab214458 at 1/200 dilution, followed by Goat Anti-Rabbit IgG, PE conjugated secondary antibody at 1/200 dilution.

References

ab214458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up