Overview

  • Product name

  • Description

    Rabbit polyclonal to MX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Horse, Cow, Dog, Pig, Rhesus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MX1 aa 40-248. Genbank: BC032602
    Sequence:

    LCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEAL SGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVE KEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQ PADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD RTIGILTKPDLVDKGTED


    Database link: P20591

  • Positive control

    • HeLa, Raji and 293T cell lysates. Human fetal pancreas tissue.

Properties

  • Form

    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 76 kDa.

Target

  • Function

    May regulate the calcium channel activity of TRPCs. Shows activity against influenza virus and VSV, a rhabdovirus.
  • Sequence similarities

    Belongs to the dynamin family.
    Contains 1 GED domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human interferon regulated resistance GTP binding protein MXA antibody
    • IFI 78 antibody
    • IFI 78K antibody
    • IFI-78K antibody
    • IFI78 antibody
    • IFI78K antibody
    • Interferon induced GTP binding protein Mx1 antibody
    • Interferon induced protein p78 antibody
    • Interferon inducible protein p78 antibody
    • Interferon regulated resistance GTP binding protein antibody
    • Interferon regulated resistance GTP binding protein MxA antibody
    • Interferon-induced GTP-binding protein Mx1 antibody
    • Interferon-induced protein p78 antibody
    • Interferon-regulated resistance GTP-binding protein MxA antibody
    • MX 1 antibody
    • MX antibody
    • MX dynamin-like GTPase 1 antibody
    • MX1 antibody
    • MX1_HUMAN antibody
    • MxA antibody
    • Myxoma resistance protein 1 antibody
    • Myxovirus (influenza virus) resistance 1 interferon inducible antibody
    • Myxovirus (influenza virus) resistance 1 interferon inducible protein p78 antibody
    • Myxovirus (influenza) resistance 1 homolog of murine antibody
    • Myxovirus resistance 1, mouse, homolog of antibody
    • Myxovirus resistance protein 1 antibody
    • N-terminally processed antibody
    see all

Images

  • All lanes : Anti-MX1 antibody (ab197205) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Raji cell lysate
    Lane 3 : 293T cell lysate

    Predicted band size: 76 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human fetal pancreas tissue labeling MX1 with ab197205 at a 1/100 dilution.

References

ab197205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (spleen, placenta, brain)
Gel Running Conditions
Reduced Denaturing (12%)
Loading amount
3 µg
Specification
spleen, placenta, brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Apr 09 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up