Overview

  • Product name

  • Description

    Rabbit polyclonal to MX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rhesus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MX1 aa 7-172.
    Sequence:

    DIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLI DSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCP LVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMG ISHELITLEISSRDVP


    Database link: P20591

  • Positive control

    • WB: A549, NIH/3T3 and HeLa whole cell lysate (ab150035). IHC-P: Human pancreatic tissue. ICC/IF: PC-3 cells. IP: HeLa whole cell lysate (ab150035).

Properties

Applications

Our Abpromise guarantee covers the use of ab222856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.
WB 1/1000 - 1/5000. Detects a band of approximately 76 kDa (predicted molecular weight: 76 kDa).

Target

  • Function

    May regulate the calcium channel activity of TRPCs. Shows activity against influenza virus and VSV, a rhabdovirus.
  • Sequence similarities

    Belongs to the dynamin family.
    Contains 1 GED domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Human interferon regulated resistance GTP binding protein MXA antibody
    • IFI 78 antibody
    • IFI 78K antibody
    • IFI-78K antibody
    • IFI78 antibody
    • IFI78K antibody
    • Interferon induced GTP binding protein Mx1 antibody
    • Interferon induced protein p78 antibody
    • Interferon inducible protein p78 antibody
    • Interferon regulated resistance GTP binding protein antibody
    • Interferon regulated resistance GTP binding protein MxA antibody
    • Interferon-induced GTP-binding protein Mx1 antibody
    • Interferon-induced protein p78 antibody
    • Interferon-regulated resistance GTP-binding protein MxA antibody
    • MX 1 antibody
    • MX antibody
    • MX dynamin-like GTPase 1 antibody
    • MX1 antibody
    • MX1_HUMAN antibody
    • MxA antibody
    • Myxoma resistance protein 1 antibody
    • Myxovirus (influenza virus) resistance 1 interferon inducible antibody
    • Myxovirus (influenza virus) resistance 1 interferon inducible protein p78 antibody
    • Myxovirus (influenza) resistance 1 homolog of murine antibody
    • Myxovirus resistance 1, mouse, homolog of antibody
    • Myxovirus resistance protein 1 antibody
    • N-terminally processed antibody
    see all

Images

  • All lanes : Anti-MX1 antibody (ab222856) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Predicted band size: 76 kDa
    Observed band size: 76 kDa

  • Paraffin-embedded human pancreatic tissue stained for MX1 using ab222856 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for MX1 (green) using ab222856 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • MX1 was immunoprecipitated from 500 µg HeLa (human epithelial cell line from cervix adenocarcinomaline) whole cell lysate with 4 µg ab222856. Western blot was performed from the immunoprecipitate using ab222856.

    Lane 1: Control IgG IP in HeLa whole cell lysate.

    Lane 2: ab222856 IP in HeLa whole cell lysate.

    Lane 3: HeLa whole cell lysate (20 µg).

    For western blotting, an HRP-conjugated light chain specific antibody was used as the secondary antibody at 1/50000 dilution.

References

ab222856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up