Overview

  • Product name

  • Description

    Rabbit polyclonal to MYBPC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MYBPC1 aa 35-168.
    Sequence:

    DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAE DLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKD NFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN


    Database link: Q00872

  • Positive control

    • IHC-P: Human skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. MyBP family.
    Contains 3 fibronectin type-III domains.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • C protein, skeletal muscle slow isoform antibody
    • C-protein antibody
    • MYBPC1 antibody
    • MYBPCC antibody
    • MYBPCS antibody
    • Myosin binding protein C, slow type antibody
    • Myosin-binding protein C antibody
    • MYPC1_HUMAN antibody
    • skeletal muscle C protein antibody
    • skeletal muscle slow isoform antibody
    • Slow MyBP C antibody
    • Slow MyBP-C antibody
    • slow-type antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for MYBPC1 using ab224114 at 1/50 dilution in immunohistochemical analysis.

References

ab224114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up