Overview

  • Product name

    Anti-Myelin oligodendrocyte glycoprotein antibody
    See all Myelin oligodendrocyte glycoprotein primary antibodies
  • Description

    Rabbit polyclonal to Myelin oligodendrocyte glycoprotein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow
    Predicted to work with: Human, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Myelin oligodendrocyte glycoprotein aa 29-153. Extracellular domain, expressed in E.coli. N-terminal tags.
    Sequence:

    GQFRVIGPGHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHL YRNGKDQDEEQAPEYRGRTQLLKETIGEGKVTLRIRNVRFSDEGGFTCFF RDHSYQEEAAMELKVEDPFYWINPG


    Database link: P55803

  • Positive control

    • WB: Recombinant cow Myelin oligodendrocyte glycoprotein protein; mouse brain and cerebrum lysate; cow brain and cerebrum lysate; rat brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.

Target

Images

  • Anti-Myelin oligodendrocyte glycoprotein antibody (ab231598) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 28 kDa

  • Anti-Myelin oligodendrocyte glycoprotein antibody (ab231598) at 2 µg/ml + Cow cerebrum lysate

    Predicted band size: 28 kDa

  • Anti-Myelin oligodendrocyte glycoprotein antibody (ab231598) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 28 kDa

  • All lanes : Anti-Myelin oligodendrocyte glycoprotein antibody (ab231598) at 3 µg/ml

    Lane 1 : Cow brain lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 28 kDa

  • Anti-Myelin oligodendrocyte glycoprotein antibody (ab231598) at 2 µg/ml + Recombinant cow Myelin Oligodendrocyte Glycoprotein protein

    Predicted band size: 28 kDa

References

ab231598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up