Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Key features and details
- Mouse monoclonal [CL2852] to Myelin oligodendrocyte glycoprotein
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852]
See all Myelin oligodendrocyte glycoprotein primary antibodies -
Description
Mouse monoclonal [CL2852] to Myelin oligodendrocyte glycoprotein -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human Myelin oligodendrocyte glycoprotein aa 43-155.
Sequence:ALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAP EYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMEL KVEDPFYWVSPG
Database link: Q16653 -
Positive control
- IHC-P: Rat cerebellum, mouse cerebellum, human cerebral cortex, rat striatum, mouse corpus callosum and human cerebellum tissues. WB: Human cerebral cortex tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
CL2852 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243034 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 1 µg/ml. |
Target
-
Function
Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. -
Tissue specificity
Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4340 Human
- Entrez Gene: 17441 Mouse
- Entrez Gene: 24558 Rat
- Omim: 159465 Human
- SwissProt: Q16653 Human
- SwissProt: Q61885 Mouse
- SwissProt: Q63345 Rat
- Unigene: 141308 Human
see all -
Alternative names
- BTN6 antibody
- BTNL11 antibody
- MGC26137 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Paraffin-embedded rat cerebellum tissue stained for oligodendrocyte glycoprotein (green) using ab243034 at 1/2500 dilution in immunohistochemical analysis.
-
Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034) at 1 µg/ml + Human cerebral cortex tissue lysate
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Paraffin-embedded mouse cerebellum tissue stained for oligodendrocyte glycoprotein (green) using ab243034 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Paraffin-embedded human cerebral cortex tissue stained for oligodendrocyte glycoprotein using ab243034 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Paraffin-embedded rat striatum tissue stained for oligodendrocyte glycoprotein (green) using ab243034 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Paraffin-embedded mouse corpus callosum tissue stained for oligodendrocyte glycoprotein (green) using ab243034 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Paraffin-embedded human cerebellum tissue stained for oligodendrocyte glycoprotein using ab243034 at 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Myelin oligodendrocyte glycoprotein antibody [CL2852] (ab243034)
Negative Control:
Paraffin-embedded human liver tissue stained for oligodendrocyte glycoprotein using ab243034 at 1/2500 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243034 has not yet been referenced specifically in any publications.