Anti-Myeloid Marker antibody [MYADM/971] (ab212997)
Key features and details
- Mouse monoclonal [MYADM/971] to Myeloid Marker
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Myeloid Marker antibody [MYADM/971]
See all Myeloid Marker primary antibodies -
Description
Mouse monoclonal [MYADM/971] to Myeloid Marker -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Macaque monkey -
Immunogen
Recombinant full length protein corresponding to Human Myeloid Marker aa 1-322.
Sequence:MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVA FSLVASVGAWTGSMGNWSMFTWCFCFSVTLIILIVELCGLQARFPLSWRN FPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAATFFSCIACVA YATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQ PALEWCVAVYAICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLL YATALVLWPLYQFDEKYGGQPRRSRDVSCSRSHAYYVCAWDRRLAVAILT AINLLAYVADLVHSAHLVFVKV
Database link: Q96S97 -
Positive control
- IHC-P: Human tonsil tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Protein A/G purified -
Clonality
Monoclonal -
Clone number
MYADM/971 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab212997 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Widely expressed. Not detected in thymus. -
Sequence similarities
Belongs to the MAL family.
Contains 2 MARVEL domains. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 91663 Human
- Omim: 609959 Human
- SwissProt: Q96S97 Human
- Unigene: 380906 Human
-
Alternative names
- myadm antibody
- MYADM_HUMAN antibody
- myeloid associated differentiation marker antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab212997 has not yet been referenced specifically in any publications.