Overview

  • Product name

  • Description

    Rabbit polyclonal to MYH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human MYH1 aa 585-794. Expressed in E.coli. N-terminal tag.
    Sequence:

    YAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLALLFVGATGAEAEA GGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKT PGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAI PEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEK LAQLITRTQA


    Database link: P12882

  • Positive control

    • WB: Recombinant human MYH1 protein; Pig skeletal muscle and heart lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Muscle contraction.
  • Sequence similarities

    Contains 1 IQ domain.
    Contains 1 myosin head-like domain.
  • Domain

    The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
    Each myosin heavy chain can be split into 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). It can later be split further into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).
  • Cellular localization

    Cytoplasm > myofibril. Thick filaments of the myofibrils.
  • Information by UniProt
  • Database links

  • Alternative names

    • adult 1 antibody
    • MGC133384 antibody
    • MYH1 antibody
    • MYH1_HUMAN antibody
    • MYHa antibody
    • MyHC 2x antibody
    • MyHC 2X/D antibody
    • MyHC IIx/d antibody
    • MyHC-2x antibody
    • MyHC-IIx/d antibody
    • MYHSA1 antibody
    • Myosin 1 antibody
    • Myosin heavy chain 1 antibody
    • Myosin heavy chain 2x antibody
    • Myosin heavy chain antibody
    • Myosin heavy chain IIx/d antibody
    • Myosin heavy chain, skeletal muscle, adult 1 antibody
    • Myosin, heavy chain 1, skeletal muscle, adult antibody
    • Myosin, heavy polypeptide 1, skeletal muscle, adult antibody
    • Myosin-1 antibody
    • skeletal muscle antibody
    see all

Images

  • Anti-MYH1 antibody (ab232968) at 2.5 µg/ml + Recombinant human MYH1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • All lanes : Anti-MYH1 antibody (ab232968) at 2.5 µg/ml

    Lane 1 : Pig skeletal muscle tissue lysate
    Lane 2 : Pig heart tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

References

ab232968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up