Overview

  • Product name

  • Description

    Rabbit polyclonal to MYL12B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Fusion protein corresponding to Human MYL12B aa 1-172. (Full length, BC004994).
    Sequence:

    MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFID KEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPE DVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDK KGNFNYIEFTRILKHGAKDKDD


    Database link: O14950

  • Positive control

    • Mouse skeletal muscle, heart and bladder tissue lysates; Human breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab197929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/100.
WB 1/450 - 1/2000. Predicted molecular weight: 20 kDa.

Target

  • Function

    Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Phosphorylation triggers actin polymerization in vascular smooth muscle. Implicated in cytokinesis, receptor capping, and cell locomotion.
  • Tissue specificity

    Ubiquitously expressed in various hematopoietic cells.
  • Sequence similarities

    Contains 3 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge. Phosphorylation is reduced following epigallocatechin-3-O-gallate treatment.
  • Information by UniProt
  • Database links

  • Alternative names

    • ML12B_HUMAN antibody
    • MLC 2A antibody
    • MLC-2 antibody
    • MLC-2a antibody
    • MLC-B antibody
    • MLC20 antibody
    • MRLC2 antibody
    • MYL12B antibody
    • MYLC2B antibody
    • Myosin light chain 12B regulatory antibody
    • Myosin regulatory light chain 12B antibody
    • myosin regulatory light chain 2 antibody
    • Myosin regulatory light chain 2-B antibody
    • myosin regulatory light chain 2-B, smooth muscle isoform antibody
    • Myosin regulatory light chain 20 kDa antibody
    • Myosin regulatory light chain MRLC2 antibody
    • myosin, light chain 12B, regulatory antibody
    • OTTHUMP00000162244 antibody
    • OTTHUMP00000165806 antibody
    • OTTHUMP00000165807 antibody
    • OTTHUMP00000165808 antibody
    • SHUJUN-1 antibody
    • smooth muscle isoform antibody
    see all

Images

  • All lanes : Anti-MYL12B antibody (ab197929) at 1/450 dilution

    Lane 1 : Mouse skeletal muscle lysate
    Lane 2 : Mouse heart tissue lysate
    Lane 3 : Mouse bladder tissue lysate

    Lysates/proteins at 40 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 20 kDa


    Exposure time: 20 seconds


    Gel: 8% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human breast cancer tissue labeling MYL12B with ab197929 at 1/20 dilution.

References

ab197929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up