Overview

  • Product name
    Anti-MYL12B antibody - C-terminal
    See all MYL12B primary antibodies
  • Description
    Rabbit polyclonal to MYL12B - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human MYL12B aa 92-141 (C terminal). The exact sequence is proprietary. (NP_291024).
    Sequence:

    EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE


    Database link: O14950

  • Positive control
    • ACHN whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab177354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function
    Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Phosphorylation triggers actin polymerization in vascular smooth muscle. Implicated in cytokinesis, receptor capping, and cell locomotion.
  • Tissue specificity
    Ubiquitously expressed in various hematopoietic cells.
  • Sequence similarities
    Contains 3 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge. Phosphorylation is reduced following epigallocatechin-3-O-gallate treatment.
  • Information by UniProt
  • Database links
  • Alternative names
    • ML12B_HUMAN antibody
    • MLC 2A antibody
    • MLC-2 antibody
    • MLC-2a antibody
    • MLC-B antibody
    • MLC20 antibody
    • MRLC2 antibody
    • MYL12B antibody
    • MYLC2B antibody
    • Myosin light chain 12B regulatory antibody
    • Myosin regulatory light chain 12B antibody
    • myosin regulatory light chain 2 antibody
    • Myosin regulatory light chain 2-B antibody
    • myosin regulatory light chain 2-B, smooth muscle isoform antibody
    • Myosin regulatory light chain 20 kDa antibody
    • Myosin regulatory light chain MRLC2 antibody
    • myosin, light chain 12B, regulatory antibody
    • OTTHUMP00000162244 antibody
    • OTTHUMP00000165806 antibody
    • OTTHUMP00000165807 antibody
    • OTTHUMP00000165808 antibody
    • SHUJUN-1 antibody
    • smooth muscle isoform antibody
    see all

Images

  • Anti-MYL12B antibody - C-terminal (ab177354) at 1 µg/ml + ACHN whole cell lysate at 10 µg

    Predicted band size: 20 kDa

References

This product has been referenced in:
  • Yin Y  et al. Expression of MYPT1, CPI-17 and MLC20 in ileum of neonatal mouse NEC model and its significance. Exp Ther Med 14:2221-2227 (2017). Read more (PubMed: 28962146) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up