Overview

  • Product name

  • Description

    Rabbit polyclonal to MYL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse MYL4 aa 4-187. (Expressed in E.coli).
    Sequence:

    KKPEPKKEAAKPAAAPAPAASAAPEPLKDSAFDPKSVKIDFSADQIEEFK EAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMS SKTLDFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRH VLATLGEKMSEAEVEQLLSGQEDANGCINYEAFV


    Database link: P09541

  • Positive control

    • WB: Rat heart lysate; Recombinant mouse MYL4 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231800 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Regulatory light chain of myosin. Does not bind calcium.
  • Sequence similarities

    Contains 3 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALC 1 antibody
    • ALC1 antibody
    • AMLC antibody
    • Atrial/embryonic alkali myosin light chain antibody
    • embryonic muscle/atrial isoform antibody
    • GT 1 antibody
    • GT1 antibody
    • MLC 1 antibody
    • MLC1 antibody
    • MYL 4 antibody
    • Myl4 antibody
    • MYL4_HUMAN antibody
    • Myosin atrial/fetal muscle light chain antibody
    • Myosin light chain 1 antibody
    • Myosin light chain 1 embryonic muscle/atrial isoform antibody
    • Myosin light chain 4 alkali atrial embryonic antibody
    • Myosin light chain 4 antibody
    • Myosin light chain alkali GT 1 isoform antibody
    • Myosin light chain alkali GT-1 isoform antibody
    • Myosin light polypeptide 4 alkali atrial embryonic antibody
    • Myosin light polypeptide 4 antibody
    • PRO1957 antibody
    see all

Images

  • Anti-MYL4 antibody (ab231800) at 2 µg/ml + Recombinant mouse MYL4 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 21 kDa

  • Anti-MYL4 antibody (ab231800) at 2 µg/ml + Rat heart lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 21 kDa

References

ab231800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up