Overview

  • Product name

  • Description

    Rabbit polyclonal to MYL7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Pig
  • Immunogen

    Recombinant fragment corresponding to Human MYL7 aa 102-173.
    Sequence:

    DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTP MDLAGNIDYKSLCYIITHGDEK


    Database link: Q01449

  • Positive control

    • WB: Caco-2 cell lysate. IHC-P: Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 19 kDa.

Target

Images

  • Paraffin-embedded human heart muscle tissue stained for MYL7 with ab224366 (1/200) in immunohistochemical analysis.

  • Anti-MYL7 antibody (ab224366) at 1/100 dilution + Caco-2 (human colorectal adenocarcinoma cell line) cell lysate

    Predicted band size: 19 kDa

References

ab224366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up