Overview

  • Product name

    Anti-MYLK4 antibody - C-terminal
    See all MYLK4 primary antibodies
  • Description

    Rabbit polyclonal to MYLK4 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human MYLK4 aa 336-385 (C terminal). The exact sequence is proprietary. (NP_001012418)
    Sequence:

    EFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDF


    Database link: Q86YV6

  • Positive control

    • RPMI-8226 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol. PubMed: 27325775
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • CaMLCK like antibody
    • EC 2.7.11.1 antibody
    • EG238564 antibody
    • Mylk4 antibody
    • MYLK4_HUMAN antibody
    • Myosin light chain kinase family member 4 antibody
    • RP11-145H9.1 antibody
    • RP23-427P14.1 antibody
    • SgK085 antibody
    • Sugen kinase 85 antibody
    see all

Images

  • Anti-SPATA31A2 antibody - N-terminal (ab178985) at 1 µg/ml + RPMI-8226 whole cell lysates at 10 µg

    Predicted band size: 45 kDa

References

This product has been referenced in:

  • Miyamoto-Mikami E  et al. Gene expression profile of muscle adaptation to high-intensity intermittent exercise training in young men. Sci Rep 8:16811 (2018). Read more (PubMed: 30429512) »
  • Chang AN  et al. Cardiac myosin light chain is phosphorylated by Ca2+/calmodulin-dependent and -independent kinase activities. Proc Natl Acad Sci U S A 113:E3824-33 (2016). WB, IHC-P ; Mouse . Read more (PubMed: 27325775) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up