Anti-MYLPF antibody (ab214313)
Key features and details
- Rabbit polyclonal to MYLPF
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-MYLPF antibody -
Description
Rabbit polyclonal to MYLPF -
Host species
Rabbit -
Specificity
ab214313 may recognize myosin light chain 5, myosin light chain 7, or myosin regulatory light chain 10. -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human -
Immunogen
Synthetic peptide within Human MYLPF aa 120-169 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Database link: Q96A32 -
Positive control
- Mouse embryonic muscle tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab214313 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000. | |
IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Expressed in fetal and adult skeletal muscle. -
Sequence similarities
Contains 3 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 29895 Human
- Entrez Gene: 17907 Mouse
- Entrez Gene: 24584 Rat
- SwissProt: Q96A32 Human
- SwissProt: P97457 Mouse
- SwissProt: P04466 Rat
- Unigene: 50889 Human
- Unigene: 6534 Rat
-
Alternative names
- 2410014J02Rik antibody
- DKFZp779C0757 antibody
- DTNB antibody
see all
Images
-
Anti-MYLPF antibody (ab214313) at 1/1000 dilution + Mouse muscle lysates
Secondary
Conjugated secondary antibody at 1/20000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MYLPF antibody (ab214313)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryonic muscle tissue labeling MYLPF with ab214313 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (0)
ab214313 has not yet been referenced specifically in any publications.