Anti-MYLPF antibody (ab214313)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MYLPF antibody
See all MYLPF primary antibodies -
Description
Rabbit polyclonal to MYLPF -
Host species
Rabbit -
Specificity
ab214313 may recognize myosin light chain 5, myosin light chain 7, or myosin regulatory light chain 10. -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human MYLPF aa 120-169 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Database link: Q96A32 -
Positive control
- Mouse embryonic muscle tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab214313 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000. | |
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Tissue specificity
Expressed in fetal and adult skeletal muscle. -
Sequence similarities
Contains 3 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 29895 Human
- Entrez Gene: 17907 Mouse
- Entrez Gene: 24584 Rat
- SwissProt: Q96A32 Human
- SwissProt: P97457 Mouse
- SwissProt: P04466 Rat
- Unigene: 50889 Human
- Unigene: 6534 Rat
-
Alternative names
- 2410014J02Rik antibody
- DKFZp779C0757 antibody
- DTNB antibody
see all
Images
-
Western blot - Anti-MYLPF antibody (ab214313)Anti-MYLPF antibody (ab214313) at 1/1000 dilution + Mouse muscle lysates
Secondary
Conjugated secondary antibody at 1/20000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MYLPF antibody (ab214313)Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse embryonic muscle tissue labeling MYLPF with ab214313 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
Protocols
Datasheets and documents
References
ab214313 has not yet been referenced specifically in any publications.
