Overview

  • Product name

  • Description

    Rabbit polyclonal to MYO1C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MYO1C aa 247-394.
    Sequence:

    GEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVVRKALTVIDF TEDEVEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEG STLREALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLV


    Database link: O00159

  • Positive control

    • ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as Myosin 1C

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. Involved in glucose transporter recycling in response to insulin by regulating movement of intracellular GLUT4-containing vesicles to the plasma membrane. Component of the hair cell's (the sensory cells of the inner ear) adaptation-motor complex. Acts as a mediator of adaptation of mechanoelectrical transduction in stereocilia of vestibular hair cells. Binds phosphoinositides and links the actin cytoskeleton to cellular membranes.
    Isoform 3 is involved in regulation of transcription. Associated with transcriptional active ribosomal genes. Appears to cooperate with the WICH chromatin-remodeling complex to facilitate transcription. Necessary for the formation of the first phosphodiester bond during transcription initiation.
  • Sequence similarities

    Contains 2 IQ domains.
    Contains 1 myosin head-like domain.
  • Domain

    Binds directly to large unilamellar vesicles (LUVs) containing phosphatidylinositol 4,5-bisphosphate (PIP2) or inositol 1,4,5-trisphosphate (InsP3). The PIP2-binding site corresponds to a putative PH domain present in its tail domain.
  • Cellular localization

    Cytoplasm. Cell membrane. Cell projection > stereocilium membrane. Colocalizes with CABP1 and CIB1 at cell margin, membrane ruffles and punctate regions on the cell membrane. Colocalizes in adipocytes with GLUT4 in actin-based membranes. Localizes transiently at cell membrane to region known to be enriched in PIP2. Activation of phospholipase C results in its redistribution to the cytoplasm and Nucleus > nucleoplasm. Nucleus > nucleolus. Nucleus > nuclear pore complex. Colocalizes with RNA polymerase II in the nucleus. Colocalizes with RNA polymerase I in nucleoli (By similarity). In the nucleolus, is localized predominantly in dense fibrillar component (DFC) and in granular component (GC). Accumulates strongly in DFC and GC during activation of transcription. Colocalizes with transcription sites. Colocalizes in the granular cortex at the periphery of the nucleolus with RPS6. Colocalizes in nucleoplasm with RPS6 and actin that are in contact with RNP particles. Colocalizes with RPS6 at the nuclear pore level.
  • Information by UniProt
  • Database links

  • Alternative names

    • MMI beta antibody
    • MMI-beta antibody
    • MMIb antibody
    • MYO1C antibody
    • MYO1C_HUMAN antibody
    • Myosin I beta antibody
    • Myosin Ic antibody
    • Myosin-Ic antibody
    • MYR2 antibody
    • NMI antibody
    • Nuclear myosin I antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2OS (human bone osteosarcoma epithelial cell line) cells stained for MYO1C (green) using ab244283 at 4 µg/ml in ICC/IF.

References

ab244283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up