Overview

  • Product name

  • Description

    Rabbit polyclonal to MYO9B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MYO9B aa 1377-1452.
    Sequence:

    TDGERSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKD KKYSLEGAEELENAVSGHVVLEATTM


    Database link: Q13459

  • Positive control

    • ICC/IF: A431 cells. IHC-P: Human tonsil tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    Myosin IX belongs to the family of unconventional myosins, distinct from the classical myosins I and myosins II. Myosin IX, thought to be involved in signal transduction and leukocyte differentiation, includes several isoforms. The rat isoforms are myosin IX/Myr5 (230 kDa) and Myr7 (300 kDa), and the human isoforms are myosin IXa (MYO9A) and myosin IXb (MYO9B). The isoforms of myosin IX have similar overall domain structure and are expressed in many tissues and cell types, although they have distinct tissue expression patterns. The subcellular localization of class IX myosins appears to be partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. The expression level of myosins IX may vary during development and differentiation.
  • Cellular localization

    Cytoplasm; cell cortex. Cytoplasm; perinuclear region. Note=In undifferentiated cells colocalizes with F-actin in the cell periphery while in differentiated cells its localization is cytoplasmic with the highest levels in the perinuclear region.
  • Database links

  • Alternative names

    • CELIAC 4 antibody
    • Celiac disease 4 antibody
    • CELIAC4 antibody
    • MYO 9B antibody
    • Myosin 9B antibody
    • Myosin IX antibody
    • Myosin IXB antibody
    • Myosin9B antibody
    • MyosinIX antibody
    • MyosinIXB antibody
    • MYR 5 antibody
    • MYR5 antibody
    • Unconventional myosin 9b antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling MYO9B using ab243451 at 4 µg/ml (green) in ICC/IF. Nuclear probe is visualized in blue.

  • Formalin-fixed, paraffin-embedded human tonsil tissue stained for MYO9B with ab243451 at 1/50 dilution in immunohistochemical analysis.

References

ab243451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up