Overview

  • Product name

    Anti-MyoD1 antibody [5.8A]
    See all MyoD1 primary antibodies
  • Description

    Mouse monoclonal [5.8A] to MyoD1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Mouse MyoD1.
    Sequence:

    MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRL VHMGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKA CKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEIL RNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASS PRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAARESRPGKSAAVSSLDC LSSIVERISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPD AAPQCPAGSNPNAIYQVL


    Database link: P10085

  • Epitope

    The epitope of ab233941 maps between amino acid 180-189 in the C terminal of mouse MyoD1 protein.
  • Positive control

    • IHC-P: Human rhabdomyosarcoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Incubate with primary antibody for 30 minutes at room temperature.

Target

  • Function

    Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates muscle-specific promoters. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications

    Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function.
    Ubiquitinated on the N-terminus; which is required for proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHc1 antibody
    • Class C basic helix-loop-helix protein 1 antibody
    • MYF 3 antibody
    • Myf-3 antibody
    • MYF3 antibody
    • Myoblast determination protein 1 antibody
    • Myod 1 antibody
    • MYOD antibody
    • MYOD1 antibody
    • MYOD1_HUMAN antibody
    • Myogenic differentiation 1 antibody
    • Myogenic factor 3 antibody
    • Myogenic factor MYF 3 antibody
    • Myogenin D1 antibody
    • PUM antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human rhabdomyosarcoma tissue stained for MyoD1 using ab233941 at 1 μg/ml in immunohistochemical analysis.

References

ab233941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up