Overview

  • Product name

    Anti-MyoD1 antibody [rMYD712]
    See all MyoD1 primary antibodies
  • Description

    Mouse monoclonal [rMYD712] to MyoD1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, Protein Arraymore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MyoD1 aa 1-320.
    Sequence:

    MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRL MHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKA CKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEIL RNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDAS SPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLD CLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS PDAAPQCPAGANPNPIYQVL


    Database link: P15172

  • Positive control

    • IHC: Human Rhabdomyosarcoma tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab238025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml.

Primary incubation for 30 minutes at room temperature.

Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 10-20 minute followed by cooling at RT for 20 minutes.

Protein Array Use at an assay dependent concentration.

Target

  • Function

    Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Activates muscle-specific promoters. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications

    Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function.
    Ubiquitinated on the N-terminus; which is required for proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHc1 antibody
    • Class C basic helix-loop-helix protein 1 antibody
    • MYF 3 antibody
    • Myf-3 antibody
    • MYF3 antibody
    • Myoblast determination protein 1 antibody
    • Myod 1 antibody
    • MYOD antibody
    • MYOD1 antibody
    • MYOD1_HUMAN antibody
    • Myogenic differentiation 1 antibody
    • Myogenic factor 3 antibody
    • Myogenic factor MYF 3 antibody
    • Myogenin D1 antibody
    • PUM antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human Rhabdomyosarcoma tissue stained for MyoD1 using ab238025 at 2 μg/mL in immunohistochemical analysis.

     

  • ab238025 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.

References

ab238025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up