Overview

  • Product name

  • Description

    Rabbit polyclonal to Myoferlin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Myoferlin aa 117-220.
    Sequence:

    TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGP KGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNI RPVV


    Database link: Q9NZM1

  • Positive control

    • WB: A431 and NIH/3T3 cell lysates. IHC-P: Human uterine cervix tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 17,230,233,235 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

  • Function

    Calcium/phospholipid-binding protein that plays a role in the plasmalemma repair mechanism of endothelial cells that permits rapid resealing of membranes disrupted by mechanical stress. Involved in endocytic recycling. Implicated in VEGF signal transduction by regulating the levels of the receptor KDR.
  • Tissue specificity

    Expressed in myoblast and endothelial cells (at protein level). Highly expressed in cardiac and skeletal muscles. Also present in lung, and at very low levels in kidney, placenta and brain.
  • Sequence similarities

    Belongs to the ferlin family.
    Contains 5 C2 domains.
  • Domain

    The C2 domain 1 associates with lipid membranes in a calcium-dependent manner.
  • Cellular localization

    Cell membrane. Nucleus membrane. Cytoplasmic vesicle membrane. Concentrated at the membrane sites of both myoblast-myoblast and myoblast-myotube fusions. Detected at the plasmalemma in endothelial cells lining intact blood vessels (By similarity). Found at nuclear and plasma membranes. Enriched in undifferentiated myoblasts near the plasma membrane in puncate structures.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fer 1 like 3, myoferlin (C. elegans) antibody
    • Fer 1 like family member 3 antibody
    • Fer 1 like protein 3 antibody
    • Fer-1-like protein 3 antibody
    • FER1L3 antibody
    • myoF antibody
    • MYOF_HUMAN antibody
    • Myoferlin antibody
    see all

Images

  • Anti-Myoferlin antibody (ab224091) at 1/100 dilution + A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 17,230,233,235 kDa

  • All lanes : Anti-Myoferlin antibody (ab224091) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 17,230,233,235 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for Myoferlin (green) using ab224091 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human uterine cervix tissue stained for Myoferlin using ab24091 at 1/200 dilution in immunohistochemical analysis.

References

ab224091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up