Overview

  • Product name

    Anti-MyoGEF antibody
  • Description

    Rabbit polyclonal to MyoGEF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MyoGEF aa 2-82.
    Sequence:

    KAFGPPHEGPLQGLVASRIETYGGRHRASAQSTTGRLYPRGYPVLDPSRR RLQQYVPFARGSGQARGLSPMRLRDPEPEKR


    Database link: Q3KR16

  • Positive control

    • ICC/IF: CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100

 

Target

  • Relevance

    MyoGEF functions as a guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. It activates RHOG but not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involving MyoGEF, MYH10 and RHOA, at the cleavage furrow to advance furrow ingression during cytokinesis. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with EZR, required for normal macropinocytosis
  • Cellular localization

    Cytoplasm; cytoskeleton, spindle pole.
  • Database links

  • Alternative names

    • FLJ10665 antibody
    • MGC126315 antibody
    • MGC126353 antibody
    • MGC126354 antibody
    • Myosin interacting guanine nucleotide exchange factor antibody
    • PH domain containing family G member 6 antibody
    • Pleckstrin homology domain containing family G (with RhoGef domain) member 6 antibody
    • Pleckstrin homology domain-containing family G member 6 antibody
    • PLEKHG6 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cell line labeling MyoGEF with ab220961 at 4 µg/mL (green).

References

ab220961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up