Overview

  • Product name

  • Description

    Rabbit polyclonal to Myogenin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Myogenin aa 115-207.
    Sequence:

    RLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSS HSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDS


    Database link: P15173

  • Positive control

    • RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • Immunofluorescent analysis of PFA-fixed, triton X-100 permeabilized RH-30 cells labeling Myogenin with ab219998 at 4 μg/ml (green).

References

ab219998 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up