Overview

  • Product name

  • Description

    Rabbit polyclonal to Myoglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Sheep, Goat
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Cow Myoglobin aa 1-154. (Expressed in E.coli).
    Sequence:

    MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHL KTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKI PVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVL GFHG


    Database link: P02192

  • Positive control

    • WB: Recombinant cow Myoglobin protein, Cow heart and skeletal muscle lysates. IHC-P: Cow cardiac and skeletal muscle tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 17 kDa.

Target

Images

  • Paraffin-embedded cow skeletal muscle tissue stained for Myoglobin using ab231530 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded cow cardiac muscle tissue stained for Myoglobin using ab231530 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Myoglobin antibody (ab231530) at 1 µg/ml

    Lane 1 : Cow heart lysate
    Lane 2 : Cow skeletal muscle lysate

    Secondary
    All lanes : HRP-linked guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 17 kDa

  • Anti-Myoglobin antibody (ab231530) at 1 µg/ml + Recombinant cow Myoglobin protein

    Secondary
    HRP-linked guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 17 kDa

References

ab231530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up