Overview

  • Product name

  • Description

    Rabbit polyclonal to Myoglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Goat
    Predicted to work with: Sheep, Cow
  • Immunogen

    Recombinant full length protein corresponding to Sheep Myoglobin aa 1-154.
    Sequence:

    MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHL KTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKI PVKYLEFISDAIIHVLHAKHPSDFGADAQGAMSKALELFRNDMAAQYKVL GFQG


    Database link: P02190

  • Positive control

    • WB: Recombinant sheep Myoglobin protein; goat skeletal muscle, cerebrum, heart and liver lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/400. Predicted molecular weight: 17 kDa.

Target

Images

  • Anti-Myoglobin antibody (ab231725) at 1/50 dilution + Recombinant shepp Myoglobin protein

    Predicted band size: 17 kDa

  • Anti-Myoglobin antibody (ab231725) at 1/50 dilution + Goat skeletal muscle lysate

    Predicted band size: 17 kDa

  • Anti-Myoglobin antibody (ab231725) at 1/50 dilution + Goat cerebrum lysate

    Predicted band size: 17 kDa

  • Anti-Myoglobin antibody (ab231725) at 1/50 dilution + Goat heart lysate

    Predicted band size: 17 kDa

  • Anti-Myoglobin antibody (ab231725) at 1/50 dilution + Goat liver lysate

    Predicted band size: 17 kDa

References

ab231725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up