Overview

  • Product name

    Anti-Myostatin Propeptide antibody [OTI6A7]
    See all Myostatin Propeptide primary antibodies
  • Description

    Mouse monoclonal [OTI6A7] to Myostatin Propeptide
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Goat, Horse, Guinea pig, Cow, Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Myostatin Propeptide aa 24-266. (NP_005250) produced in E.coli. Corresponds to full length propeptide chain.
    Sequence:

    NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNIS KDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPT ESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQI LRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNL GIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRR


    Database link: O14793

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY Myostatin Propeptide cDNA.
  • General notes

    Clone OTI6A7 (formerly 6A7).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI6A7
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 43 kDa.

Target

Images

  • All lanes : Anti-Myostatin Propeptide antibody [OTI6A7] (ab236511) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control cDNA, cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY Myostatin Propeptide cDNA, cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 43 kDa

References

ab236511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up