Overview

  • Product name

    Anti-Myozenin 1 antibody
  • Description

    Rabbit polyclonal to Myozenin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Pig
  • Immunogen

    Fusion protein corresponding to Human Myozenin 1 aa 1-299. (BC025753).
    Sequence:

    MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELS LLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGT AGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQ AGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKM ELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPL LSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL


    Database link: Q9NP98

  • Positive control

    • Mouse muscle tissue lysate; Human liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.
IHC-P 1/25 - 1/100.

Target

  • Function

    Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.
  • Tissue specificity

    Expressed primarily in skeletal muscle. Detected at lower levels in heart, prostate and pancreas.
  • Sequence similarities

    Belongs to the myozenin family.
  • Cellular localization

    Nucleus. Cell projection > pseudopodium. Localized to the nucleus and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2, FLNC and MYOT at the Z-lines of skeletal muscle.
  • Information by UniProt
  • Database links

  • Alternative names

    • actinin- and telethonin-binding protein antibody
    • Calsarcin 2 antibody
    • Calsarcin-2 antibody
    • CS 2 antibody
    • FATZ antibody
    • Filamin, actinin and telethonin binding protein antibody
    • Filamin- antibody
    • MYOZ antibody
    • MYOZ1 antibody
    • MYOZ1_HUMAN antibody
    • Myozenin-1 antibody
    • Protein FATZ antibody
    see all

Images

  • Anti-Myozenin 1 antibody (ab197660) at 1/500 dilution + Mouse muscle tissue lysate at 40 µg

    Predicted band size: 32 kDa


    Exposure time: 1 second


    10+12% SDS-PAGE.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Myozenin 1 with ab197660 at 1/25 dilution.

References

ab197660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up