Overview

  • Product name

  • Description

    Rabbit polyclonal to Myozenin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Myozenin 2 aa 90-180.
    Sequence:

    GKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKF NTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELP


    Database link: Q9NPC6

  • Positive control

    • WB: MCF7 cell lysate. IHC-P: Human heart tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.
  • Tissue specificity

    Expressed specifically in heart and skeletal muscle.
  • Involvement in disease

    Defects in MYOZ2 are the cause of familial hypertrophic cardiomyopathy type 16 (CMH16) [MIM:613838]. CMH16 is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities

    Belongs to the myozenin family.
  • Cellular localization

    Cytoplasm > myofibril > sarcomere > Z line. Colocalizes with ACTN1 and PPP3CA at the Z-line of heart and skeletal muscle.
  • Information by UniProt
  • Database links

  • Alternative names

    • C4orf5 antibody
    • Calcineurin binding protein calsarcin 1 antibody
    • Calsarcin 1 antibody
    • Calsarcin-1 antibody
    • Calsarcin1 antibody
    • CMH16 antibody
    • CS 1 antibody
    • CS1 antibody
    • FATZ related protein 2 antibody
    • FATZ-related protein 2 antibody
    • Muscle specific protein antibody
    • MYOZ 2 antibody
    • MYOZ2 antibody
    • MYOZ2_HUMAN antibody
    • Myozenin-2 antibody
    • Myozenin2 antibody
    see all

Images

  • Anti-Myozenin 2 antibody (ab237053) at 1/500 dilution + MCF7 (Human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human heart tissue stained for Myozenin 2 using ab237053 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells labeling Myozenin 2 (green) using ab237053 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated goat anti-rabbit IgG (H+L). Countersatined with DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab237053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up