Overview

  • Product name

  • Description

    Rabbit polyclonal to MYPN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human MYPN aa 945-1320. (Expressed in E.coli).
    Sequence:

    PIFDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKDGKQISKRNEHCKM RREGDGTCSLHIESTTSDDDGNYTIMAANPQGRISCSGHLMVQSLPIRSR LTSAGQSHRGRSRVQERDKEPLQERFFRPHFLQAPGDMVAHEGRLCRLDC KVSGLPPPELTWLLNGQPVLPDASHKMLVRETGVHSLLIDPLTQRDAGTY KCIATNKTGQNSFSLELSVVAKEVKKAPVILEKLQNCGVPEGHPVRLECR VIGMPPPVFYWKKDNETIPCTRERISMHQDTTGYACLLIQPAKKSDAGWY TLSAKNEAGIVSCTARLDIYAQWHHQIPPPMSVRPSGSRYGSLTSKGLDI FSAFSSMESTMVYSCSSRSVVESDEL


    Database link: Q86TC9

  • Positive control

    • WB: Pig heart and skeletal muscle lysates; Recombinant human MYPN protein. IHC-P: Human skeletal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233039 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 145 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Component of the sarcomere that tethers together nebulin (skeletal muscle) and nebulette (cardiac muscle) to alpha-actinin, at the Z lines.
  • Tissue specificity

    Expressed in adult skeletal muscle and fetal heart.
  • Sequence similarities

    Belongs to the myotilin/palladin family.
    Contains 5 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm > myofibril > sarcomere. Bound to sarcomere both at the Z-line periphery and in the central I-band region.
  • Information by UniProt
  • Database links

  • Alternative names

    • 145 kDa sarcomeric protein antibody
    • MYOP antibody
    • Myopalladin antibody
    • MYPN antibody
    • MYPN_HUMAN antibody
    • sarcomeric protein myopalladin antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for MYPN using ab233039 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-MYPN antibody (ab233039) at 2 µg/ml

    Lane 1 : Pig heart lysate
    Lane 2 : Pig skeletal muscle lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 145 kDa

  • Anti-MYPN antibody (ab233039) at 2 µg/ml + Recombinant human MYPN protein

    Predicted band size: 145 kDa

References

ab233039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up