Overview

  • Product name

  • Description

    Rabbit polyclonal to MYPOP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MYPOP aa 149-204.
    Sequence:

    ACPQRYVLSEDRREDRRADTSAHSKAGSSSPEPWARPSCTPQEGGCPRPK ERESPP


    Database link: Q86VE0

  • Positive control

    • A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Transcriptional repressor; DNA-binding protein that specifically recognizes the core sequence 5'-YAAC[GT]G-3'. Dimerization with PFN1 reduces its DNA-binding capacity.
  • Sequence similarities

    Contains 1 Myb-like domain.
  • Domain

    The proline-rich region is required for PFN1 interaction.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Myb-related protein p42POP antibody
    • myb-related transcription factor, partner of profilin antibody
    • Myodysa antibody
    • MYPOP antibody
    • MYPOP_HUMAN antibody
    • p42 Myb-related transcription factor antibody
    • Partner of profilin antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized A549 cells labeling MYPOP with ab221487 at 4 μg/ml (green).

References

ab221487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up