
  • Product name
    Anti-N Cadherin antibody [8C11]
    See all N Cadherin primary antibodies
  • Description
    Mouse monoclonal [8C11] to N Cadherin
  • Host species
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Rabbit, Hamster, Human, Bird
    Does not react with: Mouse, Rat, Cow, Pig
  • Immunogen

    Fusion protein corresponding to Human N Cadherin (extracellular). A recombinant maltose binding protein fused to the extracellular domain of human N-cadherin.

  • Epitope
    The 8C11 monoclonal binds to the extracellular domain of N-cadherin between EC3 and EC4 (PubMed ID: 12604612).
  • Positive control
    • IHC-P: Normal human heart tissue sections. ICC/IF: SH-SY5Y cells.
  • General notes

    This antibody clone is manufactured by Abcam. If you require it in a particular buffer formulation or a particular conjugate for your experiments, please contact orders@abcam.com.



Our Abpromise guarantee covers the use of ab19348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
IHC-P Use a concentration of 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.


  • Function
    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CADH2_HUMAN antibody
    • Cadherin 2 antibody
    • Cadherin 2 N cadherin neuronal antibody
    • Cadherin 2 type 1 antibody
    • Cadherin 2 type 1 N cadherin neuronal antibody
    • Cadherin 2, type 1, N-cadherin (neuronal) antibody
    • Cadherin-2 antibody
    • Cadherin2 antibody
    • Calcium dependent adhesion protein neuronal antibody
    • CD325 antibody
    • CD325 antigen antibody
    • CDH2 antibody
    • CDHN antibody
    • CDw325 antibody
    • CDw325 antigen antibody
    • N cadherin 1 antibody
    • N-cadherin antibody
    • NCAD antibody
    • Neural cadherin antibody
    • OTTHUMP00000066304 antibody
    • OTTHUMP00000067378 antibody
    see all


  • IHC image of N cadherin staining in a section of formalin-fixed paraffin-embedded normal human heart performed on a Leica BONDTM system using the standard protocol F.

    The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab19348, 1 µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.

    The inset secondary-only control image is taken from an identical assay without primary antibody.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

  • ab19348 staining N-Cadherin in SH-SY5Y (Human neuroblastoma cell line from bone marrow) cells.

    The cells were fixed with 100% methanol (5 min), permeabilized with 0.1% Tween for 5 mins and then blocked with 1% BSA/10% normal goat serum/0.3M glycine in 0.1% PBS-Tween for 1h. The cells were then incubated overnight at +4°C with ab19348 at 5 μg/ml and ab6046, Rabbit polyclonal to beta Tubulin - Loading Control, at 1/1000 dilution. Cells were then incubated with ab150117, Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) at 1/1000 dilution (shown in green) and ab150084, Goat polyclonal Secondary Antibody to Rabbit IgG - H&L (Alexa Fluor® 594) at 1/1000 dilution (shown in pseudocolor red). Nuclear DNA was labeled with DAPI (shown in blue).

    Image was taken with a confocal microscope (Leica-Microsystems, TCS SP8).

  • Immunofluorescence analysis of ARPE-19 cells, staining N Cadherin (green) with ab19348, at 1/20 dilution.

    ARPE-19 monolayer cultures were fixed in paraformaldehyde, permeabilized with 0.2% Triton X-100 for 15 min and blocked with 2% BSA for 30 min. Samples were incubated with primary antibody for 16 hours at 4°C before incubation with an Alexa Fluor® 488-conjugated donkey anti-mouse secondary IgG for 60 min.


This product has been referenced in:
  • Zhuang R  et al. CR6-interacting factor 1 inhibits invasiveness by suppressing TGF-ß-mediated epithelial-mesenchymal transition in hepatocellular carcinoma. Oncotarget 8:94759-94768 (2017). Read more (PubMed: 29212264) »
  • Qi L  et al. TRIM16 suppresses the progression of prostate tumors by inhibiting the Snail signaling pathway. Int J Mol Med 38:1734-1742 (2016). WB ; Human . Read more (PubMed: 27748839) »
See all 11 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A


Thank you for contacting us and your interest in our products.
The anti-N Cadherin antibody [8C11], ab19348, was raised against a bacterial fusion protein corresponding to the extracellular domain of N-cadherin (a domain between EC3 and EC4, amino acid residues 92-593 from human N-cadherin).
The anti-N Cadherin antibody [EPR1791-4], ab76011, meanwhile was raised against a synthetic peptide taken from within the residues 100-200 of human N-cadherin , also within the extracellular domain of the protein.
I hope this information has been of help. If you have any further questions, please do not hesitate to contact us again.

Read More


Thank you for your inquiry.

The immunogen of ab66025 is the full length protein and to our knowledge this clone was not mapped. We therefore do not know where exactly this antibody binds to within the N Cadherin.

According to SwissProt homepage the extracellular domain is aa 160-724.

We have two antibodies that will bind within this sequence and that are tested and guaranteed for WB with human samples:

https://www.abcam.com/index.html?datasheet=19348 https://www.abcam.com/index.html?datasheet=19348.

https://www.abcam.com/index.html?datasheet=95440 https://www.abcam.com/index.html?datasheet=95440.

I hope this information is helpful. Please do not hesitate to contact me again with any further questions.

Read More
Abcam has not validated the combination of species/application used in this Abreview.
Western blot
Xenopus laevis Tissue lysate - whole (Eye)
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing (8% SDS PAGE)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Jul 07 2009


Thank you for your enquiry. Here is the link to the Clustal W alignment and I will also paste the alignment below. http://www.ebi.ac.uk/cgi-bin/clustalw/result?tool=clustalw&jobid=clustalw-20060323-21275762&poll=yes The immunogen of ab19348 was a bacterial fusion protein corresponding to the extracellular domain of N-cadherin (amino acids 160-724). The immunogen of ab167 was affinity purified 80kD extracellular fragments of E-Cadherin derived from tryptic digestion of A-431 human vulva carcinoma cells (amino acids 155-707). They are both monoclonals so it is difficult to predict what epitope may be recognized as this has not been mapped. The homology is only 46%, so it is likely they do not cross-react and there is no report that they do cross-react, but I cannot guarantee that they do not cross-react. Here is the alignment so you may make an educated guess: humanNcad MCRIAGALRTLLPLLLALLQASVEASGEIALCKTGFPEDVYSAVLS-KDVHEGQPLLNVK 59 ecad ----MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVN 56 : : *. *. ** ***.* . * *:.** : *: .:. :.:..*: * .*: humanNcad FSNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAV 119 ecad FEDCTGRQRTAYFSLD-TRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDS-TYRKFSTKV 114 *.:*.*:::. * * : : ***. **:: . *.: : . : :**:** *. * .*:.. * humanNcad KLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQE 179 ecad TLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKN 174 .*. . . :::: . *.: * *:***********. ***.:****:: humanNcad LVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHA 239 ecad LVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHA 234 **:*:*::**: .: **:** *** **.*:***: :* *.**:*****:** : * :** humanNcad VDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADD-PN 298 ecad VSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVN 294 *. *** **:*::*:*.* * ***:*** ::*::*:* **: *** ** *** **** * humanNcad ALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNP 358 ecad TYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGE- 353 : *. : * *:** *. *. ******.:** * .*::*****.. ***::**:*::*: humanNcad TYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNA 418 ecad --GLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEA 411 ***.**********.***** *.. *: *:****..:::::.*.*** * *:****:* humanNcad VYRISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPP 478 ecad VYTILNDD-GGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTT-- 468 ** * ..* *:*.: *:* .***::...* :***::: ::* **. * **: .: humanNcad QSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLS 538 ecad -STATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWR 527 *****:* *:**** * *.* * :. .*.: .* :*::***:** :*:*:* * humanNcad DPANWLKIDPVNGQITTIAVLDRE-SPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLD 597 ecad DTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSD 587 *.****:*:* .* *:* * **** :***. *.* ::*:*** * :***** : * * humanNcad INDNAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRL 657 ecad VNDNAPIPEPRTIFFCER-NPKPQVINIIDADLPPNTSPFTAELTHG---ASANWTIQYN 643 :***** *: ** :*:. *. :* *: **:.**: :*. . : . **** humanNcad NGDFAQLNLKIKF-LEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIV 716 ecad DPTQESIILKPKMALEVGDYKINLKLMDNQN--KDQVTTLEVSVCDCEGAAGVCRKAQPV 701 : .: ** *: **.* *:: : : *. * *.::: *.*.**:*:. .. : * humanNcad GAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEE 776 ecad EAGLQIPAILGILGGILALLILILLLLLFLRRR---AVVKEPLLPPEDDTRDNVYYYDEE 758 *** **:.** *: ****:*:::::::** .*: *: ****.***: **** humanNcad GGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFI 836 ecad GGGEEDQDFDLSQLHRGLDARPEVTR-----NDVAPTLMSVPRYLPRPANPD--EIGNFI 811 ********:*****:: ..*:. : : : . .: : *:* *.* *. :**:** humanNcad NEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKK 896 ecad DENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKK 871 :*.*****.******************** *.********.*. :*******:** **** humanNcad LADMYGGGDD- 906 ecad LADMYGGGEDD 882 ********:* I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More


Sign up