Overview

  • Product name

  • Description

    Rabbit polyclonal to N4BP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human N4BP1 aa 250-300. The exact sequence is proprietary. (NP_694574.3).
    Sequence:

    QMDTVLSSSPDVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQF S


    Database link: O75113

  • Positive control

    • HeLa, Jurkat and 293T whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab197079 was affinity purified using an epitope specific to N4BP1 immobilized on solid support
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 100 kDa.

Target

  • Function

    Inhibitor of the E3 ubiquitin-protein ligase ITCH. Acts by interacting with the second WW domain of ITCH, leading to compete with ITCH's substrates and impairing ubiquitination of substrates.
  • Tissue specificity

    Detected in heart, lung, brain, liver, skeletal muscle, pancreas, kidney, spleen, testis and ovary.
  • Sequence similarities

    Belongs to the N4BP1 family.
  • Post-translational
    modifications

    Monoubiquitinated by NEDD4. Polyubiquitinated, leading to its degradation by the proteasome. Sumoylated by SUMO1, abrogating polyubiquitination and subsequent degradation. Desumoylated by SENP1, leading to accumulation in PML nuclear bodies.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleolus. Nucleus > PML body. Primarily localizes to the nucleolus. Also localizes to the PML nuclear bodies, when desumoylated.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ31821 antibody
    • KIAA0615 antibody
    • MGC176730 antibody
    • N4BP1 antibody
    • N4BP1_HUMAN antibody
    • NEDD4 binding protein 1 antibody
    • NEDD4-binding protein 1 antibody
    see all

Images

  • All lanes : Anti-N4BP1 antibody (ab197079) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 100 kDa


    Exposure time: 3 minutes


    Lysates prepared with NETN lysis buffer.

  • Detection of N4BP1 in immunoprecipitates of 293T whole cell lysates prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab197079 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab197079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up