Overview

  • Product name

  • Description

    Rabbit polyclonal to NAALADL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NAALADL2 aa 143-795.
    Sequence:

    GYYVHTNCPSDAPSSGTVDPQLYQEILKTIQAEDIKKSFRNLVQLYKNED DMEISKKIKTQWTSLGLEDVQFVNYSVLLDLPGPSPSTVTLSSSGQCFHP NGQPCSEEARKDSSQDLLYSYAAYSAKGTLKAEVIDVSYGMADDLKRIRK IKNVTNQIALLKLGKLPLLYKLSSLEKAGFGGVLLYIDPCDLPKTVNPSH DTFMVSLNPGGDPSTPGYPSVDESFRQSRSNLTSLLVQPISAPLVAKLIS SPKARTKNEACSSLELPNNEIRVVSMQVQTVTKLKTVTNVVGFVMGLTSP DRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMSKVKRGWRPDRTIV FCSWGGTAFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLYPVAS PSLQQLVVEKNNFNCTRRAQCPETNISSIQIQGDADYFINHLGVPIVQFA YEDIKTLEGPSFLSEARFSTRATKIEEMDPSFNLHETITKLSGEVILQIA NEPVLPFNALDIALEVQNNLKGDQPNTHQLLAMALRLRESAELFQSDEMR PANDPKERAPIRIRMLNDILQDMEKSFLVKQAPPGFYRNILYHLDEKTSR FSILIEAWEHCKPLASNETLQEALSEVLNSINSAQVYFKAGLDVFKSVLD GKN


    Database link: Q58DX5

  • Positive control

    • WB: A549 whole cell lysate; Mouse lung and kidney lysates. IHC-P: Human placenta tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000. Predicted molecular weight: 89 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May be catalytically inactive.
  • Tissue specificity

    Expressed at higher level in kidney and placenta. In embryo, it is mainly confined to duodenal and stomach endoderm, mesonephros, metanephros and pancreas.
  • Sequence similarities

    Belongs to the peptidase M28 family. M28B subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glutamate carboxypeptidase II type non peptidase homologue antibody
    • Inactive N acetylated alpha linked acidic dipeptidase like protein 2 antibody
    • Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 antibody
    • N acetylated alpha linked acidic dipeptidase like 2 antibody
    • NAALADase L2 antibody
    • NAALADL 2 antibody
    • NAALADL2 antibody
    • NADL2_HUMAN antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling NAALADL2 (green) using ab236991 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

  • Anti-NAALADL2 antibody (ab236991) at 1/2000 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 89 kDa

  • Paraffin-embedded human placenta tissue stained for NAALADL2 using ab236991 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NAALADL2 antibody (ab236991) at 1/2000 dilution

    Lane 1 : Mouse lung lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 89 kDa

References

ab236991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up