Overview

  • Product name
    Anti-NAALADL2 antibody - C-terminal
    See all NAALADL2 primary antibodies
  • Description
    Rabbit polyclonal to NAALADL2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Human, Saccharomyces cerevisiae, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse NAALADL2 aa 661-710 (C terminal). The exact sequence is proprietary.
    Sequence:

    SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND


    Database link: XP_915927.4

  • Positive control
    • Mouse liver lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab174811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa.

Sample type: Human placenta lysate

Target

  • Function
    May be catalytically inactive.
  • Tissue specificity
    Expressed at higher level in kidney and placenta. In embryo, it is mainly confined to duodenal and stomach endoderm, mesonephros, metanephros and pancreas.
  • Sequence similarities
    Belongs to the peptidase M28 family. M28B subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Glutamate carboxypeptidase II type non peptidase homologue antibody
    • Inactive N acetylated alpha linked acidic dipeptidase like protein 2 antibody
    • Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 antibody
    • N acetylated alpha linked acidic dipeptidase like 2 antibody
    • NAALADase L2 antibody
    • NAALADL 2 antibody
    • NAALADL2 antibody
    • NADL2_HUMAN antibody
    see all

Images

  • Anti-NAALADL2 antibody - C-terminal (ab174811) at 1 µg/ml + Mouse liver lysates at 10 µg

    Predicted band size: 88 kDa

References

ab174811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up